PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do014634.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 387aa    MW: 39873.8 Da    PI: 5.6049
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do014634.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.7e-18257291135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Do014634.1 257 CLHCETDKTPQWRTGPLGPKTLCNACGVRYKSGRL 291
                 99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.50.101.1E-14251288IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.268251287IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-17251301IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.76E-15252314No hitNo description
CDDcd002024.15E-14256303No hitNo description
PROSITE patternPS003440257282IPR000679Zinc finger, GATA-type
PfamPF003207.8E-16257291IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MEVAAECAGV GRVKKEADLF LVDDLLDLPC DDDDEEVQEA VVEDGEGEGS KAGACSAGAA  60
AGGSEEGAAG NASNDSSTVT ALDSCSNSLS VSGLVDGDFS GGLCEPYDQL AELEWLSNYM  120
GEDNFPTEDL KKLQLITGIP PASAATASVP APAAAAVQPS GGVLPPEAPV PGKARSKRSR  180
IAPCSWASRL LVLPPPPASP PSPASAAISP SESGTAAPAF PAKKPSKPAK KKEAPTSPVP  240
NAAAAATAAS GGEGRRCLHC ETDKTPQWRT GPLGPKTLCN ACGVRYKSGR LVPEYRPAAS  300
PTFMVSKHSN SHRKVLELRR QKEAPLHPHP HHQYQPQPQA LGHVGAVAAG GLMHAPSPLL  360
FDGPAGPLIG DDFLIHNRIG PDFRQLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146093.11e-156uncharacterized protein LOC100279625
TrEMBLB7ZZ651e-156B7ZZ65_MAIZE; C2C2-GATA transcription factor
STRINGAC202864.3_FGP0021e-156(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-57GATA transcription factor 9